PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA54G00244
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family ARF
Protein Properties Length: 630aa    MW: 71231.1 Da    PI: 8.3847
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA54G00244genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B376.82.4e-24119220199
                 EEEE-..-HHHHTT-EE--HHH.HTT.....---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
          B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.....ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                 f kvlt sd++++g +++ kk+a+e+     + +++ s++l+ +d +g +W++k+i+r++++r++lt+GW+ Fv +++L +gD++vF   + ++ el+v
  AA54G00244 119 FSKVLTASDTSTHGGFSVLKKHATEClppldMTQQTPSQELVAQDVHGYEWKFKHIFRGQPRRHLLTTGWSTFVTSKRLVVGDTFVFL--RGENNELRV 215
                 88****************************955666778*************************************************..3489999** PP

                 EEE-S CS
          B3  95 kvfrk 99 
                 +v+r+
  AA54G00244 216 GVRRA 220
                 ***97 PP

2Auxin_resp107.81.2e-35245324183
  Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                 a ha++t+++F+v+Y+Pr+  s+F+++++k+++a+++k+svGmRfkm fe+++s+err+sGtvvgv+d+++ +W++SkWr+L+
  AA54G00244 245 ACHAIQTRTMFTVYYKPRT--SQFIISLNKYLEAVRSKFSVGMRFKMPFEGDESPERRYSGTVVGVKDCSS-HWKDSKWRCLE 324
                 689***************6..9**********************************************887.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.71E-38112248IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.8E-41113234IPR015300DNA-binding pseudobarrel domain
CDDcd100177.91E-21117219No hitNo description
PfamPF023625.3E-22119220IPR003340B3 DNA binding domain
SMARTSM010192.9E-24119221IPR003340B3 DNA binding domain
PROSITE profilePS5086312.52119221IPR003340B3 DNA binding domain
PfamPF065071.9E-32245323IPR010525Auxin response factor
PfamPF023094.1E-6495546IPR033389AUX/IAA domain
SuperFamilySSF542773.63E-11505586No hitNo description
PROSITE profilePS5174524.81510593IPR000270PB1 domain
PfamPF023099.8E-6551588IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 630 aa     Download sequence    Send to blast
MANRGGDGDG EYLYDELWKL CAGPLVNVPQ AGERVYYFPQ GHMEQLEAST KQDLNKMKPL  60
FNLPPKILCT VMNVRLQAEK DTDEVYAQIT LIPEGTEVDE TMSPVPSPPK LQRPTVHSFS  120
KVLTASDTST HGGFSVLKKH ATECLPPLDM TQQTPSQELV AQDVHGYEWK FKHIFRGQPR  180
RHLLTTGWST FVTSKRLVVG DTFVFLRGEN NELRVGVRRA SHQQCNMPSS VISSHSMHLG  240
VLATACHAIQ TRTMFTVYYK PRTSQFIISL NKYLEAVRSK FSVGMRFKMP FEGDESPERR  300
YSGTVVGVKD CSSHWKDSKW RCLEVHWDEP ASIVRPDKIS PWEIELFVPS ANVAQSVVPK  360
NKRPREVSPL DISKTASNLW SPTLTQSQEF TQSCITSVLE TKVNKNSEWP MSSYSVSATP  420
QDSKLNDQMV SLVKEKKLES STTYRLFGID LAIPDEKTAH VQPMKKTNPT FDINSDLKSE  480
ISKISEEKIC ETTTQASQKE VQSKQNNSTR SRTKVQMQGV AVGRAVDVTV LNGYSDLIND  540
LENLFDIKGQ LQNHNKWEIV FTDNEGDMML MGDDPWPEFC SMVKRIFIWS KEQVKKKMTL  600
GNKLRVLLSE GKTTLTTTSS YGVVKTDKYS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1641334519353Auxin response factor 1
4ldw_A1e-1641334519353Auxin response factor 1
4ldv_A1e-1641334519353Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413488.10.0hypothetical protein EUTSA_v10024554mg
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLV4P5Z30.0V4P5Z3_EUTSA; Auxin response factor
STRINGAT4G23980.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27642762
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G23980.10.0auxin response factor 9